OSCAR (NM_130771) Human Recombinant Protein
CAT#: TP321675
Purified recombinant protein of Homo sapiens osteoclast associated, immunoglobulin-like receptor (OSCAR), transcript variant 3, 20 µg
View other "OSCAR" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221675 representing NM_130771
Red=Cloning site Green=Tags(s) MALVLILQLLTLWPLCHTDITPSVAIIVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFK PGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALP GPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVL SQRSEVLVISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570127 |
Locus ID | 126014 |
UniProt ID | Q8IYS5, A0A087X1R2 |
Refseq Size | 1440 |
Cytogenetics | 19q13.42 |
Refseq ORF | 801 |
Synonyms | PIgR-3; PIGR3 |
Summary | Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403334 | OSCAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404222 | OSCAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408890 | OSCAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403334 | Transient overexpression lysate of osteoclast associated, immunoglobulin-like receptor (OSCAR), transcript variant 4 |
CNY 3,080.00 |
|
LY404222 | Transient overexpression lysate of osteoclast associated, immunoglobulin-like receptor (OSCAR), transcript variant 1 |
CNY 3,080.00 |
|
LY408890 | Transient overexpression lysate of osteoclast associated, immunoglobulin-like receptor (OSCAR), transcript variant 5 |
CNY 3,080.00 |
|
PH321675 | OSCAR MS Standard C13 and N15-labeled recombinant protein (NP_570127) |
CNY 14,250.00 |