Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) (NM_016141) Human Recombinant Protein
CAT#: TP322010
Recombinant protein of human dynein, cytoplasmic 1, light intermediate chain 1 (DYNC1LI1), 20 µg
View other "Cytoplasmic dynein 1 light intermediate chain 1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222010 protein sequence
Red=Cloning site Green=Tags(s) MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNV LLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVS LKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQR RNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGA ALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFE DIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQK PVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057225 |
Locus ID | 51143 |
UniProt ID | Q9Y6G9 |
Refseq Size | 2517 |
Cytogenetics | 3p22.3 |
Refseq ORF | 1569 |
Synonyms | DLC-A; DNCLI1; LIC1 |
Summary | The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414168 | DYNC1LI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY414168 | Transient overexpression lysate of dynein, cytoplasmic 1, light intermediate chain 1 (DYNC1LI1) |
CNY 4,840.00 |
|
PH322010 | DYNC1LI1 MS Standard C13 and N15-labeled recombinant protein (NP_057225) |
CNY 19,520.00 |
|
TP760668 | Purified recombinant protein of Human dynein, cytoplasmic 1, light intermediate chain 1 (DYNC1LI1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Cytoplasmic dynein 1 light intermediate chain 1产品