Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein
CAT#: TP322242
Recombinant protein of human fms-related tyrosine kinase 3 ligand (FLT3LG), 20 µg
View other "Flt3 ligand" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 3,990.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222242 protein sequence
Red=Cloning site Green=Tags(s) MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT RRRTPRPGEQVPPVPSPQDLLLVEH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | FLT-3LG generate dendritic cell differentiation: Fms-like tyrosine kinase 3 ligand (Flt3L) is a nonredundant cytokine required for dendritic cell (DC) homeostasis in lymphoid tissues. FLT3L is commonly used to generate pDCs in vitro.In this experiment, 300,000 unfractioned mouse bone marrow cells were cultured with purified recombinant human FLT-3L (OriGene, TP322242) at indicated concentrations. Total live cells were counted at the day 8. |
Reference Data | |
RefSeq | NP_001450 |
Locus ID | 2323 |
UniProt ID | P49771 |
Refseq Size | 1074 |
Cytogenetics | 19q13.33 |
Refseq ORF | 705 |
Synonyms | FL; FLG3L; FLT3L |
Summary | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419927 | FLT3LG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419927 | Transient overexpression lysate of fms-related tyrosine kinase 3 ligand (FLT3LG) |
CNY 3,080.00 |
|
PH322242 | FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450) |
CNY 19,520.00 |
|
TP721050 | Purified recombinant protein of Human fms-related tyrosine kinase 3 ligand (FLT3LG), transcript variant 3 |
CNY 3,140.00 |
其它Flt3 ligand产品