TCN1 (NM_001062) Human Recombinant Protein
CAT#: TP322285
Recombinant protein of human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1), 20 µg
View other "TCN1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222285 representing NM_001062
Red=Cloning site Green=Tags(s) MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQT LMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTP LTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKAD EGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGA FSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNV TVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV RNG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001053 |
Locus ID | 6947 |
UniProt ID | P20061 |
Refseq Size | 1576 |
Cytogenetics | 11q12.1 |
Refseq ORF | 1269 |
Synonyms | HC; TC-1; TC1; TCI |
Summary | This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This protein is a major constituent of secondary granules in neutrophils and facilitates the transport of cobalamin into cells. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400432 | TCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400432 | Transient overexpression lysate of transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1) |
CNY 4,840.00 |
|
PH322285 | TCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001053) |
CNY 19,520.00 |