United States
Germany
Japan
United Kingdom
China
DGKA (NM_001345) Human Recombinant Protein
CAT＃: TP322395
Purified recombinant protein of Homo sapiens diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3, 20 µg
View other "DGKA" proteins (17)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222395 representing NM_001345
Red=Cloning site Green=Tags(s) MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 82.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001336 |
| Locus ID | 1606 |
| UniProt ID | P23743 |
| Refseq Size | 2756 |
| Cytogenetics | 12q13.2 |
| Refseq ORF | 2205 |
| Synonyms | DAGK; DAGK1; DGK-alpha |
| Summary | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Apr 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400535 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404426 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404427 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC404458 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430856 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400535 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3 |
CNY 3,080.00 |
|
| LY404426 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
CNY 3,080.00 |
|
| LY404427 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2 |
CNY 4,840.00 |
|
| LY404458 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4 |
CNY 3,080.00 |
|
| LY430856 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
CNY 4,840.00 |
|
| PH302930 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958852) |
CNY 19,520.00 |
|
| PH318968 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958853) |
CNY 19,520.00 |
|
| PH320293 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_963848) |
CNY 19,520.00 |
|
| PH322395 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336) |
CNY 14,250.00 |
|
| TP302930 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP318968 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP320293 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4, 20 µg |
CNY 2,900.00 |
DGKA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
