MAD1 (MAD1L1) (NM_001013836) Human Recombinant Protein
CAT#: TP322718
Recombinant protein of human MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 2, 20 µg
View other "MAD1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222718 protein sequence
Red=Cloning site Green=Tags(s) MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVERE KMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDA ASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQE LQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQ EELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKD KNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS ELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQS FLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLRED HSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFR KACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSI PAFLSSLTLELFSRQTVA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 82.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001013858 |
Locus ID | 8379 |
UniProt ID | Q9Y6D9 |
Refseq Size | 2717 |
Cytogenetics | 7p22.3 |
Refseq ORF | 2154 |
Synonyms | MAD1; PIG9; TP53I9; TXBP181 |
Summary | MAD1L1 is a component of the mitotic spindle-assembly checkpoint that prevents the onset of anaphase until all chromosome are properly aligned at the metaphase plate. MAD1L1 functions as a homodimer and interacts with MAD2L1. MAD1L1 may play a role in cell cycle control and tumor suppression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401184 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423037 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC423038 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401184 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 1 |
CNY 3,080.00 |
|
LY423037 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 2 |
CNY 4,840.00 |
|
LY423038 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 3 |
CNY 4,840.00 |
|
PH303471 | MAD1L1 MS Standard C13 and N15-labeled recombinant protein (NP_003541) |
CNY 19,520.00 |
|
PH322718 | MAD1L1 MS Standard C13 and N15-labeled recombinant protein (NP_001013858) |
CNY 19,520.00 |
|
TP303471 | Recombinant protein of human MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 1, 20 µg |
CNY 2,900.00 |