United States
Germany
Japan
United Kingdom
China
MCK10 (DDR1) (NM_013993) Human Recombinant Protein
CAT＃: TP322767
Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, 20 µg
View other "MCK10" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222767 representing NM_013993
Red=Cloning site Green=Tags(s) MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL NTV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 100.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054699 |
| Locus ID | 780 |
| UniProt ID | Q08345 |
| Refseq Size | 3877 |
| Cytogenetics | 6p21.33 |
| Refseq ORF | 2739 |
| Synonyms | CAK; CD167; DDR; EDDR1; HGK2; MCK10; NEP; NTRK4; PTK3; PTK3A; RTK6; TRKE |
| Summary | Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are involved in the regulation of cell growth, differentiation and metabolism. The protein encoded by this gene belongs to a subfamily of tyrosine kinase receptors with homology to Dictyostelium discoideum protein discoidin I in their extracellular domain, and that are activated by various types of collagen. Expression of this protein is restricted to epithelial cells, particularly in the kidney, lung, gastrointestinal tract, and brain. In addition, it has been shown to be significantly overexpressed in several human tumors. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400719 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415575 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC415576 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400719 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2 |
CNY 3,080.00 |
|
| LY415575 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1 |
CNY 4,840.00 |
|
| LY415576 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3 |
CNY 4,840.00 |
|
| PH322767 | DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054699) |
CNY 19,520.00 |
|
| PH322819 | DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054700) |
CNY 19,520.00 |
|
| TP322819 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP700161 | Purified recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP710141 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, residues 21-417aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
| TP710264 | Purified recombinant protein of Human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
