DNMT3B (NM_006892) Human Recombinant Protein
CAT#: TP323206
Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1, 20 µg
View other "DNMT3B" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223206 representing NM_006892
Red=Cloning site Green=Tags(s) MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR HLFAPLKDYFACE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 95.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 20 mM PB, pH 7.6, 10 mM NaCl |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Surface Plasmon Ressonance (SPR) (PMID: 27468168) |
Reference Data | |
RefSeq | NP_008823 |
Locus ID | 1789 |
UniProt ID | Q9UBC3 |
Refseq Size | 4353 |
Cytogenetics | 20q11.21 |
Refseq ORF | 2559 |
Synonyms | ICF; ICF1; M.HsaIIIB |
Summary | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
DNA G-quadruplexes show strong interaction with DNA methyltransferases in vitro
,Cree, SL;Fredericks, R;Miller, A;Pearce, FG;Filichev, V;Fee, C;Kennedy, MA;,
FEBS Lett.
,PubMed ID 27468168
[DNMT3B]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406229 | DNMT3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC416333 | DNMT3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY406229 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 3 |
CNY 4,840.00 |
|
LY416333 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1 |
CNY 4,840.00 |
|
PH323206 | DNMT3B MS Standard C13 and N15-labeled recombinant protein (NP_008823) |
CNY 19,520.00 |