Macrophage Scavenger Receptor I (MSR1) (NM_138716) Human Recombinant Protein
CAT#: TP323314
Recombinant protein of human macrophage scavenger receptor 1 (MSR1), transcript variant SR-AIII, 20 µg
View other "Macrophage Scavenger Receptor I" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223314 representing NM_138716
Red=Cloning site Green=Tags(s) MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGI VAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEH FQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQE EISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLSTGPIW LNEVFCFGRESSIEECKIRQWGTRACSHSEDAGVTCTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_619730 |
Locus ID | 4481 |
UniProt ID | P21757 |
Refseq Size | 3493 |
Cytogenetics | 8p22 |
Refseq ORF | 1164 |
Synonyms | CD204; phSR1; phSR2; SCARA1; SR-A; SR-AI; SR-AII; SR-AIII; SRA |
Summary | This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403366 | MSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408527 | MSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419319 | MSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403366 | Transient overexpression lysate of macrophage scavenger receptor 1 (MSR1), transcript variant SR-AI |
CNY 3,080.00 |
|
LY408527 | Transient overexpression lysate of macrophage scavenger receptor 1 (MSR1), transcript variant SR-AIII |
CNY 3,080.00 |
|
LY419319 | Transient overexpression lysate of macrophage scavenger receptor 1 (MSR1), transcript variant SR-AII |
CNY 3,080.00 |
|
PH312931 | MSR1 MS Standard C13 and N15-labeled recombinant protein (NP_002436) |
CNY 19,520.00 |
|
PH323314 | MSR1 MS Standard C13 and N15-labeled recombinant protein (NP_619730) |
CNY 19,520.00 |
|
TP312931 | Recombinant protein of human macrophage scavenger receptor 1 (MSR1), transcript variant SR-AII, 20 µg |
CNY 2,900.00 |
|
TP761290 | Purified recombinant protein of Human macrophage scavenger receptor 1 (MSR1), transcript variant SR-AI, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Macrophage Scavenger Receptor I产品