Activin Receptor Type IA (ACVR1) (NM_001111067) Human Recombinant Protein
CAT#: TP325877
Recombinant protein of human activin A receptor, type I (ACVR1), transcript variant 2, 20 µg
View other "Activin Receptor Type IA" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225877 representing NM_001111067
Red=Cloning site Green=Tags(s) MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLAC LLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITL LECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLW LITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQC CIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALR IKKTLTKIDNSLDKLKTDC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001104537 |
Locus ID | 90 |
UniProt ID | Q04771, D3DPA4 |
Cytogenetics | 2q24.1 |
Refseq ORF | 1527 |
Synonyms | ACTRI; ACVR1A; ACVRLK2; ALK2; FOP; SKR1; TSRI |
Summary | Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420209 | ACVR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426349 | ACVR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420209 | Transient overexpression lysate of activin A receptor, type I (ACVR1), transcript variant 1 |
CNY 3,080.00 |
|
LY426349 | Transient overexpression lysate of activin A receptor, type I (ACVR1), transcript variant 2 |
CNY 3,080.00 |
|
PH307486 | ACVR1 MS Standard C13 and N15-labeled recombinant protein (NP_001096) |
CNY 19,520.00 |
|
PH325877 | ACVR1 MS Standard C13 and N15-labeled recombinant protein (NP_001104537) |
CNY 19,520.00 |
|
TP307486 | Recombinant protein of human activin A receptor, type I (ACVR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Activin Receptor Type IA产品