GDNF Receptor alpha 1 (GFRA1) (NM_001145453) Human Recombinant Protein
CAT#: TP326704
Recombinant protein of human GDNF family receptor alpha 1 (GFRA1), transcript variant 3, 20 µg
View other "GDNF Receptor alpha 1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226704 representing NM_001145453
Red=Cloning site Green=Tags(s) MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKD ECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISV EHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCS CRDIACTERRRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADC LLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQ PAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNYEKEGL GASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLSLTETS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138925 |
Locus ID | 2674 |
UniProt ID | P56159 |
Cytogenetics | 10q25.3 |
Refseq ORF | 1380 |
Synonyms | GDNFR; GDNFRA; GFR-ALPHA-1; GFRalpha-1; RET1L; RETL1; TRNR1 |
Summary | This gene encodes a member of the glial cell line-derived neurotrophic factor receptor (GDNFR) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature receptor. Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. This receptor is a glycosylphosphatidylinositol (GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407880 | GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417417 | GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428898 | GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407880 | Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 2 |
CNY 3,080.00 |
|
LY417417 | Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 1 |
CNY 4,840.00 |
|
LY428898 | Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 3 |
CNY 3,080.00 |
|
PH326704 | GFRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001138925) |
CNY 19,520.00 |
|
TP720395 | Recombinant protein of human GDNF family receptor alpha 1 (GFRA1), transcript variant 3 |
CNY 3,140.00 |
其它GDNF Receptor alpha 1产品