RNF185 (NM_001135825) Human Recombinant Protein
CAT#: TP326760
Purified recombinant protein of Homo sapiens ring finger protein 185 (RNF185), transcript variant 3, 20 µg
View other "RNF185" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226760 representing NM_001135825
Red=Cloning site Green=Tags(s) MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQGFQGF GFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129297 |
Locus ID | 91445 |
UniProt ID | Q96GF1, A0A024R1H4 |
Cytogenetics | 22q12.2 |
Refseq ORF | 408 |
Summary | E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1 (PubMed:21931693). Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation (PubMed:27485036). Protects cells from ER stress-induced apoptosis (PubMed:27485036). Responsible for the cotranslational ubiquitination and degradation of CFTR in the ERAD pathway (PubMed:24019521). Preferentially associates with the E2 enzymes UBE2J1 and UBE2J2 (PubMed:24019521).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407689 | RNF185 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427719 | RNF185 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427720 | RNF185 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407689 | Transient overexpression lysate of ring finger protein 185 (RNF185), transcript variant 1 |
CNY 3,080.00 |
|
LY427719 | Transient overexpression lysate of ring finger protein 185 (RNF185), transcript variant 2 |
CNY 3,080.00 |
|
LY427720 | Transient overexpression lysate of ring finger protein 185 (RNF185), transcript variant 3 |
CNY 3,080.00 |
|
PH326760 | RNF185 MS Standard C13 and N15-labeled recombinant protein (NP_001129297) |
CNY 14,250.00 |