14-3-3 zeta (YWHAZ) (NM_001135699) Human Recombinant Protein
CAT#: TP326946
Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3, 20 µg
View other "14-3-3 zeta" proteins (23)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226946 representing NM_001135699
Red=Cloning site Green=Tags(s) MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001129171 |
Locus ID | 7534 |
UniProt ID | P63104 |
Refseq Size | 3020 |
Cytogenetics | 8q22.3 |
Refseq ORF | 735 |
Synonyms | 14-3-3-zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; POPCHAS; YWHAD |
Summary | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008] |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401160 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407895 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427673 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427674 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427675 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427676 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430139 | YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401160 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1 |
CNY 3,080.00 |
|
LY407895 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 |
CNY 3,080.00 |
|
LY427673 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3 |
CNY 3,080.00 |
|
LY427674 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4 |
CNY 3,080.00 |
|
LY427675 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5 |
CNY 3,080.00 |
|
LY427676 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6 |
CNY 3,080.00 |
|
LY430139 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 |
CNY 3,080.00 |
|
PH309909 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_003397) |
CNY 19,520.00 |
|
PH326946 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129171) |
CNY 14,250.00 |
|
PH326999 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129172) |
CNY 14,250.00 |
|
PH327007 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129173) |
CNY 14,250.00 |
|
PH327049 | YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129174) |
CNY 14,250.00 |
|
TP309909 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326999 | Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP327007 | Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP327049 | Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6, 20 µg |
CNY 2,900.00 |
其它14-3-3 zeta产品