United States
Germany
Japan
United Kingdom
China
ZNF447 (ZSCAN18) (NM_001145543) Human Recombinant Protein
CAT＃: TP327637
Recombinant protein of human zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4, 20 µg
View other "ZNF447" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227637 protein sequence
Red=Cloning site Green=Tags(s) MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ RQSVIQQPAPDRGTAKLGTKRPHPEDGDEQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA GGPPESVEGEAPPAPPEAQR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001139015 |
| Locus ID | 65982 |
| UniProt ID | Q8TBC5 |
| Refseq Size | 2716 |
| Cytogenetics | 19q13.43 |
| Refseq ORF | 1530 |
| Synonyms | ZNF447 |
| Summary | May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402961 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428933 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428934 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402961 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 3 |
CNY 3,080.00 |
|
| LY428933 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 1 |
CNY 3,080.00 |
|
| LY428934 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4 |
CNY 3,080.00 |
|
| PH303390 | ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_076415) |
CNY 14,250.00 |
|
| PH327637 | ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_001139015) |
CNY 19,520.00 |
|
| TP303390 | Purified recombinant protein of Homo sapiens zinc finger and SCAN domain containing 18 (ZSCAN18), 20 µg |
CNY 2,900.00 |
