FGF1 (NM_001144935) Human Recombinant Protein
CAT#: TP327797
Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6, 20 µg
View other "FGF1" proteins (18)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227797 protein sequence
Red=Cloning site Green=Tags(s) MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY GQKAILFLPLPVSSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138407 |
Locus ID | 2246 |
UniProt ID | P05230 |
Refseq Size | 3781 |
Cytogenetics | 5q31.3 |
Refseq ORF | 465 |
Synonyms | AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGFA; GLIO703; HBGF-1; HBGF1 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400278 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428552 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428587 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428588 | FGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400278 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
CNY 3,080.00 |
|
LY428552 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4 |
CNY 3,080.00 |
|
LY428587 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5 |
CNY 3,080.00 |
|
LY428588 | Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6 |
CNY 3,080.00 |
|
PH307434 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) |
CNY 19,520.00 |
|
PH327317 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138364) |
CNY 14,250.00 |
|
PH327790 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138406) |
CNY 14,250.00 |
|
PH327797 | FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138407) |
CNY 14,250.00 |
|
TP307434 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327317 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP327790 | Purified recombinant protein of Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP720040 | Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
CNY 1,800.00 |
|
TP721185 | Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1 |
CNY 1,800.00 |
|
TP750001 | Recombinant protein of human Fibroblast Growth Factor-acidic (FGF1) produced in E. coli |
CNY 2,040.00 |