ASXL1 (NM_001164603) Human Recombinant Protein
CAT#: TP328030
Recombinant protein of human additional sex combs like 1 (ASXL1), 20 µg
View other "ASXL1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228030 representing NM_001164603
Red=Cloning site Green=Tags(s) MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAMLHSNSRGGEGL FYKLPGRISLFTLKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001158075 |
Locus ID | 171023 |
UniProt ID | Q498B9 |
Cytogenetics | 20q11.21 |
Refseq ORF | 255 |
Synonyms | BOPS; MDS |
Summary | This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414600 | ASXL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC431058 | ASXL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414600 | Transient overexpression lysate of additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 1 |
CNY 4,840.00 |
|
LY431058 | Transient overexpression lysate of additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 2 |
CNY 3,080.00 |
|
TP720991 | Purified recombinant protein of Human additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 1 |
CNY 5,460.00 |