FHL1 (NM_001159700) Human Recombinant Protein
CAT#: TP328799
Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 3, 20 µg
View other "FHL1" proteins (17)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228799 representing NM_001159700
Red=Cloning site Green=Tags(s) MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV DCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001153172 |
Locus ID | 2273 |
UniProt ID | Q13642 |
Cytogenetics | Xq26.3 |
Refseq ORF | 840 |
Synonyms | FCMSU; FHL-1; FHL1A; FHL1B; FLH1A; KYOT; RBMX1A; RBMX1B; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA |
Summary | This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. Expression of these family members occurs in a cell- and tissue-specific mode and these proteins are involved in many cellular processes. Mutations in this gene have been found in patients with Emery-Dreifuss muscular dystrophy. Multiple alternately spliced transcript variants which encode different protein isoforms have been described.[provided by RefSeq, Nov 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400563 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431153 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431271 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431283 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431827 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431828 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400563 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 |
CNY 3,080.00 |
|
LY431153 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 6 |
CNY 3,080.00 |
|
LY431271 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 5 |
CNY 3,080.00 |
|
LY431283 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 1 |
CNY 3,080.00 |
|
LY431827 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 3 |
CNY 3,080.00 |
|
LY431828 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 4 |
CNY 3,080.00 |
|
PH303478 | FHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001440) |
CNY 19,520.00 |
|
TP303478 | Recombinant protein of human four and a half LIM domains 1 (FHL1), 20 µg |
CNY 2,900.00 |
|
TP328125 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP328243 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP328800 | Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 4, 20 µg |
CNY 2,900.00 |