Eif4ebp3 (NM_201256) Mouse Recombinant Protein
CAT#: TP500316
Purified recombinant protein of Mouse eukaryotic translation initiation factor 4E binding protein 3 (Eif4ebp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200316 representing NM_201256
Red=Cloning site Green=Tags(s) MSSSTSCPIPGCRDQLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTL PAVPPSKLELLKEQKQTEVEITDDEQFEMDM myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 11.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_957708 |
Locus ID | 108112 |
UniProt ID | Q80VV3 |
Refseq Size | 1151 |
Cytogenetics | 18 B2 |
Refseq ORF | 303 |
Synonyms | 4e-bp3 |
Summary | Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Eif4ebp3产品