Mif (NM_010798) Mouse Recombinant Protein
CAT#: TP500478
Purified recombinant protein of Mouse macrophage migration inhibitory factor (glycosylation-inhibiting factor) (Mif), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200478 protein sequence
Red=Cloning site Green=Tags(s) MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGG AQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 12.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034928 |
Locus ID | 17319 |
UniProt ID | P34884 |
Refseq Size | 554 |
Cytogenetics | 10 C1 |
Refseq ORF | 348 |
Synonyms | GIF; Glif |
Summary | Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP721159 | Purified recombinant protein of Mouse macrophage migration inhibitory factor (Mif) |
CNY 3,140.00 |