Uqcc2 (NM_026063) Mouse Recombinant Protein

CAT#: TP500838

Purified recombinant protein of Mouse ubiquinol-cytochrome c reductase complex assembly factor 2 (Uqcc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200838 protein sequence
Red=Cloning site Green=Tags(s)

MAALRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQIAEPEACDQMYESLARLHSNYYKH
KYPRPRDTSFSGLSVEEYKLILSTDTLEEFQEMNKSMWKKLQEKFAPTRPEEKHKAWTRVLSRPRT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 16.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080339
Locus ID 67267
UniProt ID Q9CQY6
Refseq Size 473
Cytogenetics 17 A3.3
Refseq ORF 411
Synonyms 2900010M23Rik; Cbp6; M19; Mnf1
Summary Required for the assembly of the ubiquinol-cytochrome c reductase complex (mitochondrial respiratory chain complex III or cytochrome b-c1 complex). Plays a role in the modulation of respiratory chain activities such as oxygen consumption and ATP production and via its modulation of the respiratory chain activity can regulate skeletal muscle differentiation and insulin secretion by pancreatic beta-cells. Involved in cytochrome b translation and/or stability.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...