Dnajc15 (NM_025384) Mouse Recombinant Protein
CAT#: TP501048
Purified recombinant protein of Mouse DnaJ heat shock protein family (Hsp40) member C15 (Dnajc15), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201048 protein sequence
Red=Cloning site Green=Tags(s) MATGGGVTSREGLRYAEYLPPSAQRSDADIDHTAGRRLLAVGLGVAAVAFAGRYAFQIWKPLEQVITATA RKISSPSFSSYYKGGFEQKMSKREASLILGVSPSAGKAKIRTAHKRIMILNHPDKGGSPYLASKINEAKD LLEASSKAN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079660 |
Locus ID | 66148 |
UniProt ID | Q78YY6 |
Refseq Size | 671 |
Cytogenetics | 14 D3 |
Refseq ORF | 450 |
Synonyms | 1110003P16Rik; Dnajd1 |
Summary | Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9 (By similarity). Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Dnajc15产品