Myl6 (BC081470) Mouse Recombinant Protein
CAT#: TP501072
Purified recombinant protein of Mouse myosin, light polypeptide 6, alkali, smooth muscle and non-muscle (cDNA clone MGC:102200 IMAGE:6824167), complete, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201072 protein sequence
Red=Cloning site Green=Tags(s) MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN YEELVRMVLNG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 17904 |
UniProt ID | Q60605 |
Refseq Size | 646 |
Cytogenetics | 10 D3 |
Refseq ORF | 453 |
Synonyms | ESMLC, LC17A, LC17B, MLC1SM, MLC3SM, LC17-GI, LC17-NM, MLC3NM |
Summary | Regulatory light chain of myosin. Does not bind calcium.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |