Fam89b (NM_023166) Mouse Recombinant Protein
CAT#: TP501546
Purified recombinant protein of Mouse family with sequence similarity 89, member B (Fam89b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201546 protein sequence
Red=Cloning site Green=Tags(s) MNGLPATEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAG SANSGSAAGPRRPVNLDSALAALRKEMLWGLYESIQDYKHLCQDLSLCQDLSSSLHSDSSYPPDAGLSDD EEPPDASLPPDPPPLTVPQTHNARDQWLQDAFQISL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 18.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_075655 |
Locus ID | 17826 |
UniProt ID | Q7TMI7 |
Refseq Size | 1190 |
Cytogenetics | 19 4.34 cM |
Refseq ORF | 531 |
Synonyms | 1110021A21Rik; MMTV; Mtvr2 |
Summary | Negatively regulates TGF-beta-induced signaling; in cooperation with SKI prevents the translocation of SMAD2 from the nucleus to the cytoplasm in response to TGF-beta (PubMed:12646588). Acts as an adapter that mediates the specific recognition of LIMK1 by CDC42BPA and CDC42BPB in the lamellipodia. LRAP25-mediated CDC42BPA/CDC42BPB targeting to LIMK1 and the lamellipodium results in LIMK1 activation and the subsequent phosphorylation of CFL1 which is important for lamellipodial F-actin regulation (PubMed:25107909).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |