Isg20 (NM_001113527) Mouse Recombinant Protein
CAT#: TP501635
Purified recombinant protein of Mouse interferon-stimulated protein (Isg20), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201635 protein sequence
Red=Cloning site Green=Tags(s) MAGIPEVVAMDCEMVGLGPQRVSGLARCSIVNIHGAVLYDKYIRPEGEITDYRTQVSGVTPQHMVRATPF GEARLEILQLLKGKLVVGHDLKHDFNALKEDMSKYTIYDTSTDRLLWHEAKLQYYSRVSLRLLCKRLLHK NIQNNWRGHCSVEDARATMELYKISQRLRAQRGLPCPGTSD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001106999 |
Locus ID | 57444 |
UniProt ID | Q9JL16 |
Refseq Size | 907 |
Cytogenetics | 7 D2 |
Refseq ORF | 546 |
Synonyms | 20kDa; 1600023I01Rik; 2010107M23Rik; DnaQL; HEM45 |
Summary | Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |