Pgrmc1 (NM_016783) Mouse Recombinant Protein
CAT#: TP501910
Purified recombinant protein of Mouse progesterone receptor membrane component 1 (Pgrmc1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201910 representing NM_016783
Red=Cloning site Green=Tags(s) MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKR RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD DLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDETARKNE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_058063 |
Locus ID | 53328 |
UniProt ID | O55022 |
Refseq Size | 1838 |
Cytogenetics | X A3.3 |
Refseq ORF | 585 |
Synonyms | AA415812; HPR6.6; mPR; PPMR; Vema |
Summary | Component of a progesterone-binding protein complex. Binds progesterone. Has many reported cellular functions (heme homeostasis, interaction with CYPs).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |