Cmtm4 (NM_153582) Mouse Recombinant Protein
CAT#: TP502216
Purified recombinant protein of Mouse CKLF-like MARVEL transmembrane domain containing 4 (Cmtm4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202216 protein sequence
Red=Cloning site Green=Tags(s) MRGGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI CIETIMECSPCEGLYFFEFVSCSAFVVTGVLLILFSLNLHMRIPQINWNLTDLVNTGLSTFFFFIASIVL AALNHKTGAEIAAVIFGFLATAAYAVSTFLAMQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_705810 |
Locus ID | 97487 |
UniProt ID | Q8CJ61 |
Refseq Size | 7734 |
Cytogenetics | 8 D3 |
Refseq ORF | 627 |
Synonyms | Cklfsf4; D19397; ENSMUSG00000051554; Gm9853 |
Summary | Acts as a backup for CMTM6 to regulate plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity. May protect PD-L1/CD274 from being polyubiquitinated and targeted for degradation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |