Cd99l2 (NM_138309) Mouse Recombinant Protein
CAT#: TP502341
Purified recombinant protein of Mouse CD99 antigen-like 2 (Cd99l2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202341 protein sequence
Red=Cloning site Green=Tags(s) MVARLTAFLVCLVFSLATLVQRGYGDTDGFNLEDALKETSSVKQRWDHVATTTTRRPGTTRAPSNPMELD GFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTI AGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVTYSKQETQSAEPPPPE PPRI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612182 |
Locus ID | 171486 |
UniProt ID | Q8BIF0 |
Refseq Size | 3548 |
Cytogenetics | X A7.3 |
Refseq ORF | 645 |
Synonyms | AW548191; Mic2l1; Xap89 |
Summary | Plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Homophilic adhesion molecule, but these interactions may not be required for cell aggregation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |