Nudt5 (NM_016918) Mouse Recombinant Protein
CAT#: TP502441
Purified recombinant protein of Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 5 (Nudt5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202441 protein sequence
Red=Cloning site Green=Tags(s) METRESTESSPGKHLVTSEELISEGKWVKFEKTTYMDPTGKTRTWETVKLTTRKGKSADAVSVIPVLQRT LHHECVILVKQFRPPMGSYCLEFPAGFIEDGENPEAAALRELEEETGYKGEVAECSPAVCMDPGLSNCTT HVVTVTINGDDAGNVRPKPKPGDGEFMEVISLPKNDLLTRLDALGAEQHLTVDAKVYAYGLALKHANSKP FEVPFLKF myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 24 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_058614 |
Locus ID | 53893 |
UniProt ID | Q9JKX6 |
Refseq Size | 1590 |
Cytogenetics | 2 A1 |
Refseq ORF | 657 |
Summary | Enzyme that can either act as an ADP-sugar pyrophosphatase in absence of diphosphate or catalyze the synthesis of ATP in presence of diphosphate (By similarity). In absence of diphosphate, hydrolyzes with similar activities various modified nucleoside diphosphates such as ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP (PubMed:10722730). Can also hydrolyze other nucleotide sugars with low activity (PubMed:10722730). In presence of diphosphate, mediates the synthesis of ATP in the nucleus by catalyzing the conversion of ADP-ribose to ATP and ribose 5-phosphate (By similarity). Nuclear ATP synthesis takes place when dephosphorylated at Thr-44 (By similarity). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (By similarity). Does not play a role in U8 snoRNA decapping activity (PubMed:21070968). Binds U8 snoRNA (PubMed:21070968).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |