Mmachc (NM_025962) Mouse Recombinant Protein
CAT#: TP502551
Purified recombinant protein of Mouse methylmalonic aciduria cblC type, with homocystinuria (Mmachc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202551 protein sequence
Red=Cloning site Green=Tags(s) MFDRALKPFLKSCHFQTLRDPVDQCVSYHLRSVTEKFPEVHMEVIADYEVHPNRRPKILAQTAAHVAGAA YYYQRQDVDADPWGTQHIAGVCIHPRFGGWFAIRGVMLLPGIEVPNLPPRKPPDCVPTRAGRITLLEGFN FHWRDWTYRDAVTPEERYSEEQKIYFSTPPAQRLALLGLAQPSEHPSTTSELPLSLLTKPQNSRRARSWL SPSVSPPVSPGP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080238 |
Locus ID | 67096 |
UniProt ID | Q9CZD0 |
Refseq Size | 1950 |
Cytogenetics | 4 D1 |
Refseq ORF | 669 |
Synonyms | 1810037K07Rik; CblC |
Summary | Catalyzes the reductive dealkylation of cyanocobalamin to cob(II)alamin, using FAD or FMN as cofactor and NADPH as cosubstrate. Can also catalyze the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. Under anaerobic conditions cob(I)alamin is the first product; it is highly reactive and is converted to aquocob(II)alamin in the presence of oxygen. Binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |