Cenph (NM_021886) Mouse Recombinant Protein

CAT#: TP502979

Purified recombinant protein of Mouse centromere protein H (Cenph), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202979 protein sequence
Red=Cloning site Green=Tags(s)

MEEQPRERSEAGAEACEEKRGLSQAAEERIEDRISLLLRLRAQTKQQLLEYKSMIDTNEEKTPEQIMQEK
QIEVKIEELENEIEDVKSNIEMKSLALSRMKLSVALRDNMENMGPENCVLTDDMKHILKLQKLIMKSQEE
SSELEKKLLDVRKKRLQLKQASRSKLLEIQIEKNKQKEDVDKMENSEMIKTMKKKLQTEIKITTVVQHTF
QGLILASKTNWAEDPALRETVLQLEKDLTTL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_068686
Locus ID 26886
UniProt ID Q9QYM8
Refseq Size 1239
Cytogenetics 13 D1
Refseq ORF 726
Synonyms 1700021I11Rik; 2410018A12Rik; 2610042E16Rik; 2810046K12Rik; AU044255; CENP-H; ENP
Summary Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...