Usb1 (NM_133954) Mouse Recombinant Protein

CAT#: TP503537

Purified recombinant protein of Mouse U6 snRNA biogenesis 1 (Usb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203537 protein sequence
Red=Cloning site Green=Tags(s)

MSSAPLVGYSSSGSEDEAEAVAAGRSKPGTGFHRCGQNPVPSEKLPVPDSVLSMFPSTEEGPEDDSAKHG
GRIRTFPHERGNWATHIYIPYEAKEDFRDLLDALLPRAQMFVPRLVLMEEFHVSLSQSVVLRHHWILPFV
QVLKDRMASFQRFFFTANRVKIYTNQEKTRTFIGLEVSSGHAQFLDLVSEVDRAMKEFDLTTFYQDPSFH
ISLAWCVGDASLQLEGQCLQELQEIVDEFEDSEMLLRVLANQVRCKSGNKFFSMPLK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598715
Locus ID 101985
UniProt ID Q91W78
Refseq Size 1764
Cytogenetics 8 C5
Refseq ORF 804
Synonyms AA960436
Summary Phosphodiesterase responsible for the U6 snRNA 3' end processing. Acts as an exoribonuclease (RNase) responsible for trimming the poly(U) tract of the last nucleotides in the pre-U6 snRNA molecule, leading to the formation of mature U6 snRNA 3' end-terminated with a 2',3'-cyclic phosphate.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...