Agfg2 (NM_145566) Mouse Recombinant Protein

CAT#: TP503963

Purified recombinant protein of Mouse ArfGAP with FG repeats 2 (Agfg2), transcript variant 1, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203963 protein sequence
Red=Cloning site Green=Tags(s)

MVMAAKKGPGPGGGVGGSKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTC
SGLLRGLNPPHRVKSISMTTFTEPEVLFLQSRGNEVCRKIWLGLFDARTSLIPDSRDPQKVKEFLQEKYE
KKRWYVPPEQVKGPSYSKGSVSATPVQGSVPEGKPIRTLLGDPVPSLSDPASTSSQPGSQSQARSSSQAR
SSQPPSHSSTKKASTDLLADIGGDPFAAPQVVPAFASFPGFGGKYYPGAGTRLRRICITAKTSLVHRGLT
FLCGWGQGAA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 231801
UniProt ID Q80WC7
Refseq Size 1497
Cytogenetics 5 G2
Refseq ORF 873
Synonyms A630095P14Rik; Hrbl; RABR
Summary This gene encodes a paralog of the HIV-1 Rev binding proteins that serve as cellular co-factors for HIV-1 Rev protein in shuttling viral pre-mRNAs from the nucleus to the cytoplasm. The encoded protein contains an ADP-ribosylation factor GTPase activating protein (Arf-GAP) zinc finger domain, several phenylalanine-glycine (FG) motifs and asparagine-proline-phenylalanine (NPF) motifs. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...