Rsph1 (NM_025290) Mouse Recombinant Protein

CAT#: TP504219

Purified recombinant protein of Mouse radial spoke head 1 homolog (Chlamydomonas) (Rsph1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204219 protein sequence
Red=Cloning site Green=Tags(s)

MSDLGSEELEEEGENDLGEYEGERNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGD
YVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGT
WVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFDIGCEQHGEYRLTDTERGEEEEEEETLVNIVPKW
KALNITELALWTPTLSEEQPPPEGQGQEEPQGLTGVGDPSEDIQAEGFEGELEPRGADEDVDTFRQESQE
NSYDIDQGNLNFDEEPSDLQD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079566
Locus ID 22092
UniProt ID Q8VIG3
Refseq Size 1164
Cytogenetics 17 15.94 cM
Refseq ORF 906
Synonyms MCA; Tsga2
Summary The specific expression during male germ cell development and its characteristic localization suggest that it may play an important role in male meiosis. It is necessary for proper building of the axonemal central pair and radial spokes (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...