Isgf3g (BC005435) Mouse Recombinant Protein

CAT#: TP506259

Purified recombinant protein of Mouse interferon dependent positive acting transcription factor 3 gamma (cDNA clone MGC:5974 IMAGE:3601255), complete, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206259 representing BC005435
Red=Cloning site Green=Tags(s)

MASGKVRCTRKLRSWIVEQVESGHFPGVCWDDAAKTMFRIPWKHAGKQDFREDQDAAIFKAWALFKEKHK
DGDIGHPAVWKTRLRCALNKSSEFEEVPERGRMDVAEPYKVYRILPAGTLPNQPRNQKSPCKRSISCVSP
EREENMENGRTNGVVNHSDSGSNIGGGGNGSNRSDSNSNCNSELEEGAGTTEATIREDPVFLEHQLPLNS
DYSLLLTFIYGGRVVGKTQVHSLDCRLVAERSDSESSMEQVEFPKPDPLEPTQHLLNQLDRGVLVASNSR
GLFVQRLCPIPISWNAPEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYFQGQGPPPKFQATLHFWEESP
GSSHSQENLITVQMEQAFARHLLEKIPEEEKAALFLLQHTEQSPSALGH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 85.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 16391
UniProt ID Q61179
Refseq Size 2341
Cytogenetics 14 28.19 cM
Refseq ORF 1197
Synonyms p48, Irf-9
Summary Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...