Terf1 (NM_009352) Mouse Recombinant Protein

CAT#: TP506702

Purified recombinant protein of Mouse telomeric repeat binding factor 1 (Terf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206702 protein sequence
Red=Cloning site Green=Tags(s)

MAETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVAAGWMLDFLC
LSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVASGKALDAQFEVDERITPLES
ALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAEEVFERIFGDPEFYTPLERKLLKIISQKDV
FHSLFQHFSYSCMMEKIQSYVGDVLSEKSSTFLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNK
EKSVNGQQSTETEPLVDTVSSIRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLC
VSENQPDTDDKSGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLI
S

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033378
Locus ID 21749
UniProt ID P70371
Refseq Size 2268
Cytogenetics 1 4.88 cM
Refseq ORF 1266
Synonyms P; Pin2; Trbf; Trbf1; Trf; Trf1
Summary This gene encodes a protein that binds to repeats in telomeres to form a nucleoprotein complex that protects against the degradation of chromosomal ends. The encoded protein regulates the length of telomeres and is an integral structural component of the functional telomere. This protein is thought to play a role in spindle formation in mitosis. Mutations in this gene are associated with bone marrow failure. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...