Stambp (NM_024239) Mouse Recombinant Protein

CAT#: TP506746

Purified recombinant protein of Mouse STAM binding protein (Stambp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206746 protein sequence
Red=Cloning site Green=Tags(s)

MSDHGDVSLPPQDRVRILSQLGSAVELNEDIPPRRYYRSGVEIIRMASVYSEEGNIEHAFILYNKYITLF
IEKLPKHRDYKSAIIPEKKDAVKKLKSVAFPKAEELKTELLRRYTKEYEQYKERKKKEEEELARNIAIQQ
ELEKEKQRVAQQKQKQLEQEQFHAFEEMIQRQELEKERLKIVQEFGKVDPGPCGPLLPDLEKPCVDVAPS
SPFSPTQTPDCNTGMRPAKPPVVDRSLKPGALSVIENVPTIEGLRHIVVPRNLCSEFLQLASANTAKGIE
TCGVLCGKLMRNEFTITHVLIPRQNGGPDYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLH
THCSYQMMLPESIAIVCSPKFQETGFFKLTDYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRIVTI
TDLR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_077201
Locus ID 70527
UniProt ID Q9CQ26
Refseq Size 2157
Cytogenetics 6 C3
Refseq ORF 1275
Synonyms 5330424L14Rik; 5730422L11Rik; Amsh; AW107289; mKIAA4198
Summary Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains (By similarity). Plays a role in signal transduction for cell growth and MYC induction mediated by IL-2 and GM-CSF. Potentiates BMP (bone morphogenetic protein) signaling by antagonizing the inhibitory action of SMAD6 and SMAD7 (By similarity). Involved in the ubiquitin-dependent sorting and trafficking of receptors from endosomes to lysosome. Endosomal localization of STAMBP is required for efficient EGFR degradation but not for its internalization. Involved in the negative regulation of PI3K-AKT-mTOR and RAS-MAP signaling pathways (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...