Pold2 (NM_008894) Mouse Recombinant Protein
CAT#: TP507508
Purified recombinant protein of Mouse polymerase (DNA directed), delta 2, regulatory subunit (Pold2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
货期*
4周
规格
Product images
经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207508 protein sequence
Red=Cloning site Green=Tags(s) MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERSFNRQYAHIYATRLIQMRPFLVSRAQ QHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQPSILREISEEHNLVPQPPRSKYIHPDDELVLEDELQ RIKLKGTIDVSKLVTGTVLAVLGSAKDDGRFQVEDHCFADLAPQKPVPPLDTDRFVLLVSGLGLGGGGGE SLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLD EILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED QVVLLVAVPDFSSTQTACLVNLRSLACQPISFAGFGAEQEDLEGLGLGP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 51.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032920 |
Locus ID | 18972 |
UniProt ID | O35654 |
Refseq Size | 1634 |
Cytogenetics | 11 A1 |
Refseq ORF | 1410 |
Synonyms | 50kDa; p50; po1D2 |
Summary | As a component of the trimeric and tetrameric DNA polymerase delta complexes (Pol-delta3 and Pol-delta4, respectively), plays a role in high fidelity genome replication, including in lagging strand synthesis, and repair. Pol-delta3 and Pol-delta4 are characterized by the absence or the presence of POLD4. They exhibit differences in catalytic activity. Most notably, Pol-delta3 shows higher proofreading activity than Pol-delta4. Although both Pol-delta3 and Pol-delta4 process Okazaki fragments in vitro, Pol-delta3 may also be better suited to fulfill this task, exhibiting near-absence of strand displacement activity compared to Pol-delta4 and stalling on encounter with the 5'-blocking oligonucleotides. Pol-delta3 idling process may avoid the formation of a gap, while maintaining a nick that can be readily ligated. Along with DNA polymerase kappa, DNA polymerase delta carries out approximately half of nucleotide excision repair (NER) synthesis following UV irradiation. Under conditions of DNA replication stress, required for the repair of broken replication forks through break-induced replication (BIR). Involved in the translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites performed by Pol-delta4, independently of DNA polymerase zeta (REV3L) or eta (POLH). Facilitates abasic site bypass by DNA polymerase delta by promoting extension from the nucleotide inserted opposite the lesion. Also involved in TLS as a component of the POLZ complex. Along with POLD3, dramatically increases the efficiency and processivity of DNA synthesis of the minimal DNA polymerase zeta complex, consisting of only REV3L and REV7.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...