Pdzk1 (NM_021517) Mouse Recombinant Protein

CAT#: TP508307

Purified recombinant protein of Mouse PDZ domain containing 1 (Pdzk1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
PDZK1 Antibody - middle region
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208307 protein sequence
Red=Cloning site Green=Tags(s)

MASTFNPRECKLSKQEGQNYGFFLRIEKDTDGHLIRVIEEGSPAEKAGLLDGDRVLRINGVFVDKEEHAQ
VVELVRKSGNSVTLLVLDGDSYEKAVKNQVDLKELDQSQREAALNDKKPGPGMNGAVEPCAQPRLCYLVK
EGNSFGFSLKTIQGKKGVYLTDIMPQGVAMKAGVLADDHLIEVNGENVENASHEEVVEKVTKSGSRIMFL
LVDKETARCHSEQKTQFKRETASLKLLPHQPRVVVIKKGSNGYGFYLRAGPEQKGQIIKDIEPGSPAEAA
GLKNNDLVVAVNGKSVEALDHDGVVEMIRKGGDQTTLLVLDKEAESIYSLARFSPLLYCQSQELPNGSVK
EGPAPIPAPLEATGSEPTEDAEGHKPKLCRLLKEDDSYGFHLNAIRGQPGSFVKEVQQGGPADKAGLENE
DVIIEVNGENVQEEPYDRVVERIKSSGKHVTLLVCGKMAYSYFQAKKIPIVSSMAEPLVAGPDEKGETSA
ESEHDAHPAKDRTLSTASHSSSNSEDTEM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 56.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067492
Locus ID 59020
UniProt ID Q9JIL4
Refseq Size 2435
Cytogenetics 3 F2.1
Refseq ORF 1560
Synonyms 1700023D20Rik; 2610507N21Rik; 4921513F16Rik; AI267131; AI314638; AL022680; D3Ertd537e
Summary A scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. May be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. May play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. May potentiate the CFTR chloride channel activity (By similarity). Required for normal cell-surface expression of SCARB1. Plays a role in maintaining normal plasma cholesterol levels via its effects on SCARB1. Plays a role in the normal localization and function of the chloride-anion exchanger SLC26A6 to the plasma membrane in the brush border of the proximal tubule of the kidney. May be involved in the regulation of proximal tubular Na(+)-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...