Mettl16 (NM_026197) Mouse Recombinant Protein

CAT#: TP508777

Purified recombinant protein of Mouse methyltransferase like 16 (Mettl16), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208777 protein sequence
Red=Cloning site Green=Tags(s)

MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHIQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDI
PLERLIPTVPLRLNYIHWVEDLIGHQDSDKTTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFN
YAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIVYDFCMCNPPFFANQLEAKGVNSRNSRRPPPSSV
NTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTFTEFCQGRT
MRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLESVMKELSLKASSLGSETAEGIVVVTTWIEKIL
TDLKVQHKRIPCGREEVSLFLTAIENSWIHLRRKRRERVRQLREVPRAPEDVILALEERKSTPKELSSGQ
DVAHSPQESALCGLDVPGGEAAADGGHCLSQKLLCQEETPEATEDERDEERGGMEAMESCKGSSNGAQDG
EASEKGDRLDGAAGRYLFKCLVNIKKEAGDAVVEMHWVEGQNRDLMNQLCTYVRNQILRLVAS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 62.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080473
Locus ID 67493
UniProt ID Q9CQG2
Refseq Size 2718
Cytogenetics 11 B5
Refseq ORF 1662
Synonyms 2610100D03Rik; 2810013M15Rik; A830095F14Rik; AI846133; Mett10d
Summary RNA N6-methyltransferase that methylates adenosine residues at the N(6) position of a subset of RNAs and is involved in S-adenosyl-L-methionine homeostasis by regulating expression of MAT2A transcripts (PubMed:29262316, PubMed:30197299). Able to N6-methylate a subset of mRNAs and U6 small nuclear RNAs (U6 snRNAs) (By similarity). In contrast to the METTL3-METTL14 heterodimer, only able to methylate a limited number of RNAs: requires both a 5'UACAGAGAA-3' nonamer sequence and a specific RNA structure (By similarity). Plays a key role in S-adenosyl-L-methionine homeostasis by mediating N6-methylation of MAT2A mRNAs, altering splicing and/or stability of MAT2A transcripts: in presence of S-adenosyl-L-methionine, binds the 3' UTR region of MAT2A mRNA and specifically N6-methylates the first hairpin of MAT2A mRNA, impairing MAT2A expression (PubMed:29262316, PubMed:30197299). In S-adenosyl-L-methionine-limiting conditions, binds the 3' UTR region of MAT2A mRNA but stalls due to the lack of a methyl donor, preventing N6-methylation and promoting expression of MAT2A (PubMed:29262316). In addition to mRNAs, also able to mediate N6-methylation of U6 small nuclear RNA (U6 snRNA): specifically N6-methylates adenine in position 43 of U6 snRNAs (By similarity). Also able to bind various lncRNAs (By similarity). Specifically binds the 3'-end of the MALAT1 long non-coding RNA (By similarity) (PubMed:29262316, PubMed:30197299).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...