Ppp1r16b (NM_001159662) Mouse Recombinant Protein

CAT#: TP508959

Purified recombinant protein of Mouse protein phosphatase 1, regulatory subunit 16B (Ppp1r16b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208959 protein sequence
Red=Cloning site Green=Tags(s)

MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRRKKVSFEASV
ALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHA
AATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMIS
DIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAEL
LVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRAS
LSDRTNLYRKEYEGEAILWQQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFSTKISRGE
LDGPVENGLRAPVSTYQYALANGDIWKMHEMPDYSMAYGNPGVADVPPPWSGFKEQSPQTLLELKRQRAA
AKLLSHPFLSTHLGSSVARSGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAPMEEMEEK
VHGCCRIS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001153134
Locus ID 228852
UniProt ID Q8VHQ3, Q544H9
Refseq Size 6392
Cytogenetics 2 H1
Refseq ORF 1707
Synonyms ANKRD4; C130078N17Rik; TIMAP; Wdt4
Summary Regulator of protein phosphatase 1 (PP1) that acts as a positive regulator of pulmonary endothelial cell (EC) barrier function. Protects the endothelial barrier from lipopolysaccharide (LPS)-induced vascular leakage (PubMed:21907835). Involved in the regulation of the PI3K/AKT signaling pathway (By similarity). Involved in the regulation of angiogenesis and endothelial cell proliferation through the control of ECE1 dephosphorylation, trafficking and activity (By similarity). Involved in the regulation of endothelial cell filopodia extension (By similarity). May be a downstream target for TGF-beta1 signaling cascade in endothelial cells (By similarity). Involved in PKA-mediated moesin dephosphorylation which is important in EC barrier protection against thrombin stimulation. Promotes the interaction of PPP1CA with RPSA/LAMR1 and in turn facilitates the dephosphorylation of RPSA/LAMR1 (By similarity). Involved in the dephosphorylation of EEF1A1 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...