Nfatc4 (NM_023699) Mouse Recombinant Protein
CAT#: TP511104
Purified recombinant protein of Mouse nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 4 (Nfatc4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR211104 representing NM_023699
Red=Cloning site Green=Tags(s) MGAASCEDEELEFKLVFGEEKEPPPLGPGGPGEELDSEDTPPCCRLALGEPLPYGAAPIGIPRPPPPRPG MHSPPPRPAPSPGTWESQPARSVRLGGPGGNAGGAGGGRVLECPSIRITSISPTPDPPTSLEDTSETWGD GSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVESELNEAASRFG LSSPLPSPRASPRPWTPEDPWSLYGPSSGGRAPEDSWLLLSAPGPVPASPRPASPCGKRRYSSSGTPSSA SPALSRRGSLGEEGPEPPPPPPLPLVRDPSSPGPFDYVGAPPTESIPQKTRRTSSEQAVALPRSEEPPSC NGKLPSGTEDSVAAPGALRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERSLRPHAFYQVHRITGK MVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQ GGGKVVSVQAASVPIECSQRSAQELPQVETYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQW EEEAAVNRLQSSEVTLTLTIPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFKFLPVVFKEEPLPDSSLRG FPSTSGPPFGPDVDFSPPRPPYPSYPHEDPAYETPYLSEGFGYSTPALYPQTGPPPSYRSGLRMFPETGG TTGCARLPSVSFLPRPFPGDQYGGQGSSFALGLPFSPPAPFRPPLPSSPPLEDPFHPQSAIHPLPPEGYN EVGPGYTPGEGASEQEKARGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPARPGEEPPA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 95.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076188 |
Locus ID | 73181 |
UniProt ID | Q8K120 |
Refseq Size | 3284 |
Cytogenetics | 14 C3 |
Refseq ORF | 2703 |
Synonyms | 3110041H08Rik; AW107667; AW546455; Nfat3 |
Summary | Ca(2+)-regulated transcription factor that is involved in several processes, including the development and function of the immune, cardiovascular, musculoskeletal, and nervous systems. Involved in T-cell activation, stimulating the transcription of cytokine genes, including that of IL2 and IL4 (PubMed:17198697). Along with NFATC3, involved in embryonic heart development (PubMed:12750314, PubMed:17198697). Involved in mitochondrial energy metabolism required for cardiac morphogenesis and function (PubMed:12750314). Transactivates many genes involved in heart physiology. Along with GATA4, binds to and activates NPPB/BNP promoter (PubMed:9568714). Activates NPPA/ANP/ANF and MYH7/beta-MHC transcription (By similarity). Binds to and transactivates AGTR2 gene promoter (PubMed:17198697). Involved in the regulation of adult hippocampal neurogenesis. Involved in BDNF-driven pro-survival signaling in hippocampal adult-born neurons. Involved in the formation of long-term spatial memory and long-term potentiation (PubMed:22586092). In cochlear nucleus neurons, may play a role in deafferentation-induced apoptosis during a developmental critical period when auditory neurons depend on afferent input for survival (PubMed:18354019). Binds to and activates the BACE1/Beta-secretase 1 promoter, hence may regulate the proteolytic processing of the amyloid precursor protein (APP). Plays a role in adipocyte differentiation. May be involved in myoblast differentiation into myotubes (By similarity). Binds the consensus DNA sequence 5'-GGAAAAT-3' (Probable). In the presence of CREBBP, activates TNF transcription. Binds to PPARG gene promoter and regulates its activity (By similarity). Binds to PPARG and REG3G gene promoters (PubMed:17198697).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |