Ficd (NM_001010825) Mouse Recombinant Protein

CAT#: TP516189

Purified recombinant protein of Mouse FIC domain containing (Ficd), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR216189 representing NM_001010825
Red=Cloning site Green=Tags(s)

MILMPMASVVAVAEPKWVSVWGRFLWMALLSMALGSLLALLLPLGVVEEHCLAVLRGFHLLRSKLDRAQP
VVPKCTSLCTELSVSSRDAGLLTVKTTASPAGKLEAKAALNQALEMKRQGKRGKAHKLFLHALKMDPGFV
DALNEFGIFSEEDKDIIQADYLYTRALTISPFHEKALVNRDRTLPLVEEIDQRYFSVIDSKVKKVMSIPK
GSSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVS
RIGSVTMDDMLEIHRRVLGYVDPVEAGRFRRTQVLVGHHIPPHPRDVEKQMQEFTQWLNSEDAMNLHPVE
FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEVANEGDVRPFIRFIAK
CTEVTLDTLLLATTEYSVALPEAQPNHSGFKETLPVRP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001010825
Locus ID 231630
UniProt ID Q8BIX9
Refseq Size 3192
Cytogenetics 5 55.55 cM
Refseq ORF 1374
Synonyms D5Ertd40e; Hype
Summary Protein that can both mediate the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins (AMPylation), and the removal of the same modification from target proteins (de-AMPylation), depending on the context (By similarity). The side chain of Glu-231 determines which of the two opposing activities (AMPylase or de-AMPylase) will take place (By similarity). Acts as a key regulator of the ERN1/IRE1-mediated unfolded protein response (UPR) by mediating AMPylation or de-AMPylation of HSPA5/BiP (By similarity). In unstressed cells, acts as an adenylyltransferase by mediating AMPylation of HSPA5/BiP at 'Thr-518', thereby inactivating it (By similarity). In response to endoplasmic reticulum stress, acts as a phosphodiesterase by mediating removal of ATP (de-AMPylation) from HSPA5/BiP at 'Thr-518', leading to restore HSPA5/BiP activity (By similarity). Although it is able to AMPylate RhoA, Rac and Cdc42 Rho GTPases in vitro, Rho GTPases do not constitute physiological substrates (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...