Nme5 (NM_080637) Mouse Recombinant Protein
CAT#: TP516332
Purified recombinant protein of Mouse NME/NM23 family member 5 (Nme5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR216332 representing NM_080637
Red=Cloning site Green=Tags(s) MEVSMPLPQIYVEKTLALIKPDVVDKEEEIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNL TAYMSSGPLVAMILARHKAISYWKELMGPSNSLVAKETHPDSLRAIYGTDELRNALHGSNDFAASEREIR FMFPAVIIEPIPIGQAAKDYINLYVAPTLLQGLTELCKEKPPDPYLWLADWLMKNNPNKPKLCHFPVTEE P myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 24 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542368 |
Locus ID | 75533 |
UniProt ID | Q99MH5 |
Refseq Size | 829 |
Cytogenetics | 18 B1 |
Refseq ORF | 633 |
Synonyms | 1700019D05Rik; Nm23-M5 |
Summary | Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |