Cdnf (NM_177647) Mouse Recombinant Protein
CAT#: TP517152
Purified recombinant protein of Mouse cerebral dopamine neurotrophic factor (Cdnf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR217152 protein sequence
Red=Cloning site Green=Tags(s) MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNF CSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLW KMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_808315 |
Locus ID | 227526 |
UniProt ID | Q8CC36 |
Refseq Size | 3013 |
Cytogenetics | 2 A1 |
Refseq ORF | 564 |
Synonyms | 9330140G23; Armetl1 |
Summary | Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |