Psmf1 (NM_212446) Mouse Recombinant Protein

CAT#: TP518495

Purified recombinant protein of Mouse proteasome (prosome, macropain) inhibitor subunit 1 (Psmf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218495 protein sequence
Red=Cloning site Green=Tags(s)

MAGLEVLFASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPGPSDKKSELLPAKWNSNKELYALRYE
SKDGARKLLLKAVSVENGMIINVLELGTQQVADLTLNLDDYIDAEDLSDFHRTYKNSEELRSQIRSGIIT
PIHEQWEKARANSPPREFPPATAREVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIV
DPLRSGFPRVLIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_997611
Locus ID 228769
UniProt ID Q8BHL8
Refseq Size 3542
Cytogenetics 2 G3
Refseq ORF 816
Synonyms AW048666; BC012260; PI31
Summary Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...