Psmf1 (NM_212446) Mouse Recombinant Protein
CAT#: TP518495
Purified recombinant protein of Mouse proteasome (prosome, macropain) inhibitor subunit 1 (Psmf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR218495 protein sequence
Red=Cloning site Green=Tags(s) MAGLEVLFASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPGPSDKKSELLPAKWNSNKELYALRYE SKDGARKLLLKAVSVENGMIINVLELGTQQVADLTLNLDDYIDAEDLSDFHRTYKNSEELRSQIRSGIIT PIHEQWEKARANSPPREFPPATAREVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIV DPLRSGFPRVLIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 29.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997611 |
Locus ID | 228769 |
UniProt ID | Q8BHL8 |
Refseq Size | 3542 |
Cytogenetics | 2 G3 |
Refseq ORF | 816 |
Synonyms | AW048666; BC012260; PI31 |
Summary | Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |