Nucks1 (NM_001145804) Mouse Recombinant Protein
CAT#: TP518534
Purified recombinant protein of Mouse nuclear casein kinase and cyclin-dependent kinase substrate 1 (Nucks1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR218534 representing NM_001145804
Red=Cloning site Green=Tags(s) MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPAKKIRSSPREAKNKRRSGKNSQEDSEDSEEKDVKTKK DDSHSAEDSEDEKDDHKNVRQQRQAASKAASKQREMLLEDVGSEEEPEEDDEAPFQENSGSDEDFLMEDD DDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKAKVGRPTASKKSKEKTPSPKEEDEE AESPPEKKSGDEGSEDEASSGED myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139276 |
Locus ID | 98415 |
UniProt ID | Q80XU3, A0A087WRY3 |
Refseq Size | 6093 |
Cytogenetics | 1 E4 |
Refseq ORF | 699 |
Synonyms | 2700010L10Rik; 8430423A01Rik; AI647518; C78391; Nucks |
Summary | Chromatin-associated protein involved in DNA repair by promoting homologous recombination (HR). Binds double-stranded DNA (dsDNA) and secondary DNA structures, such as D-loop structures, but with less affinity than RAD51AP1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |