Nucks1 (NM_001145804) Mouse Recombinant Protein

CAT#: TP518534

Purified recombinant protein of Mouse nuclear casein kinase and cyclin-dependent kinase substrate 1 (Nucks1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218534 representing NM_001145804
Red=Cloning site Green=Tags(s)

MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPAKKIRSSPREAKNKRRSGKNSQEDSEDSEEKDVKTKK
DDSHSAEDSEDEKDDHKNVRQQRQAASKAASKQREMLLEDVGSEEEPEEDDEAPFQENSGSDEDFLMEDD
DDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKAKVGRPTASKKSKEKTPSPKEEDEE
AESPPEKKSGDEGSEDEASSGED

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001139276
Locus ID 98415
UniProt ID Q80XU3, A0A087WRY3
Refseq Size 6093
Cytogenetics 1 E4
Refseq ORF 699
Synonyms 2700010L10Rik; 8430423A01Rik; AI647518; C78391; Nucks
Summary Chromatin-associated protein involved in DNA repair by promoting homologous recombination (HR). Binds double-stranded DNA (dsDNA) and secondary DNA structures, such as D-loop structures, but with less affinity than RAD51AP1.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...