Dcxr (NM_026428) Mouse Recombinant Protein
CAT#: TP519279
Purified recombinant protein of Mouse dicarbonyl L-xylulose reductase (Dcxr), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR219279 representing NM_026428
Red=Cloning site Green=Tags(s) MDLGLAGRRALVTGAGKGIGRSTVLALKAAGAQVVAVSRTREDLDDLVRECPGVEPVCVDLADWEATEQA LSNVGPVDLLVNNAAVALLQPFLEVTKEACDTSFNVNLRAVIQVSQIVAKGMIARGVPGAIVNVSSQASQ RALTNHTVYCSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTPMGRTNWSDPHKAKAMLDRIPLGKFA EVENVVDTILFLLSNRSGMTTGSTLPVDGGFLAT TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 26.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080704 |
Locus ID | 67880 |
UniProt ID | Q91X52 |
Refseq Size | 918 |
Cytogenetics | 11 E2 |
Refseq ORF | 732 |
Synonyms | 0610038K04Rik; 1810027P18Rik; XR |
Summary | Catalyzes the NADPH-dependent reduction of several pentoses, tetroses, trioses, alpha-dicarbonyl compounds and L-xylulose. Participates in the uronate cycle of glucose metabolism. May play a role in the water absorption and cellular osmoregulation in the proximal renal tubules by producing xylitol, an osmolyte, thereby preventing osmolytic stress from occurring in the renal tubules.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |