Npm3 (NM_008723) Mouse Recombinant Protein
CAT#: TP520197
Purified recombinant protein of Mouse nucleoplasmin 3 (Npm3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220197 representing NM_008723
Red=Cloning site Green=Tags(s) MAAGAAAALAFLNQESRARAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDTEHVLALNMLC LTEGATDECNVVEVVARDHDNQEIAVPVANLRLSCQPMLSVDDFQLQPPVTFRLKSGSGPVRITGRHQIV CINNDLSEEESDDESEEDEIKLCGILPAKKHRGRP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032749 |
Locus ID | 18150 |
UniProt ID | Q9CPP0 |
Refseq Size | 866 |
Cytogenetics | 19 38.75 cM |
Refseq ORF | 525 |
Synonyms | Nub1 |
Summary | Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning. Modulates the histone chaperone function and the RNA-binding activity of nucleolar phosphoprotein B23/NPM. Efficiently mediates chromatin remodeling when included in a pentamer containing NPM3 and NPM.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |