Rnf166 (NM_001033142) Mouse Recombinant Protein

CAT#: TP521146

Purified recombinant protein of Mouse ring finger protein 166 (Rnf166), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Rnf166 Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221146 representing NM_001033142
Red=Cloning site Green=Tags(s)

MAMFRSLVASAQQRQPPAGPAGGDSGLEAQFSCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCP
LCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRAHISSCLKVQEQMANCPKFVPVVPTSQPI
PSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFLQHLLHRHKF
SYDTFVDYSIDEEAAFQAALALSLSEN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001028314
Locus ID 68718
UniProt ID Q3U9F6, A2RS02
Refseq Size 1783
Cytogenetics 8 E1
Refseq ORF 711
Synonyms 1110031E24Rik; AW555115; Zfp313l
Summary E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates. In turn, participates in different biological processes including interferon production or autophagy. Plays a role in the activation of RNA virus-induced interferon-beta production by promoting the ubiquitination of TRAF3 and TRAF6. Plays also a role in the early recruitment of autophagy adapters to bacteria. Mediates 'Lys-29' and 'Lys-33'-linked ubiquitination of SQSTM1 leading to xenophagic targeting of bacteria and inhibition of their replication.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...