Csf2 (NM_009969) Mouse Recombinant Protein

CAT#: TP522594

Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



  View other "Csf2" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Rabbit polyclonal anti-GM-CSF antibody
    • 100 ug

CNY 8,025.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222594 representing NM_009969
Red=Cloning site Green=Tags(s)

MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQ
TRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQ
K

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 16.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034099
Locus ID 12981
UniProt ID P01587
Refseq Size 1033
Cytogenetics 11 32.13 cM
Refseq ORF 423
Synonyms CSF; Csfgm; Gm-CSf; GMCSF; MGI-IGM
Summary Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...